PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr024426.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 533aa    MW: 59947.8 Da    PI: 7.0991
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr024426.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.51.7e-14249295148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g W++eEd  lv++v ++G + W+ Ia  +  gR +kqc++rw+++l
      Pbr024426.1 249 KGQWSPEEDRHLVQLVGRFGIKKWSQIATQLT-GRVGKQCRERWHNHL 295
                      799****************************9.*************97 PP

2Myb_DNA-binding46.77.4e-15301337745
                      HHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   7 eEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      eEd++l++a+k+ G++ W+ Ia++++ gRt++ +k++w+
      Pbr024426.1 301 EEDKILIEAHKEIGNR-WSEIAKMLP-GRTENTIKNHWN 337
                      9***************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.3E-22243300IPR009057Homeodomain-like
PROSITE profilePS5129427.34244299IPR017930Myb domain
SuperFamilySSF466895.75E-29246336IPR009057Homeodomain-like
SMARTSM007176.6E-12248297IPR001005SANT/Myb domain
CDDcd001678.22E-12252295No hitNo description
PfamPF139212.7E-13252300No hitNo description
SMARTSM007174.7E-9300342IPR001005SANT/Myb domain
PROSITE profilePS5129414.011300344IPR017930Myb domain
CDDcd001673.63E-11301340No hitNo description
PfamPF002493.0E-13301337IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.8E-16301338IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 533 aa     Download sequence    Send to blast
MEYLETNLRE LDNFPFLSTL LSDSSNPLKL MKPENPPPST TTKTTTINGN IYSVSRSSPP  60
PPNSPKALFH HPNSTIHGFN WNSHSHEYNL TPKINHFTTT EASSSSNPFS KISTTCNTLN  120
NPFEPSPYTA NHHHHDFMTS DCRESESVVM HGFHGGVRGF LGYQPHHQEI LHDQQMGAES  180
CVQLPQLVNY GEFGSSSVPA MRLPSDDVSS NSIIAEIEFG RRFSADEKNK RLCARRAIKM  240
LQKKPDIIKG QWSPEEDRHL VQLVGRFGIK KWSQIATQLT GRVGKQCRER WHNHLRPDIR  300
EEDKILIEAH KEIGNRWSEI AKMLPGRTEN TIKNHWNATK RKQNSKRKSN KQDSNINNYN  360
ESSILQDYIR SLVGTTATDT TASPNSTGTT ENKAGLSSVV SPDHQSGMHI DQNNIVESPD  420
ATNSANWDLM GYRPEPIDSE ASNMNNHMGV GVNLSDFDKI NMFNVFESYG LGGYLQQGMA  480
SSSTSRVKDP SCNMAYELPF LPLETNNFMQ GHDNHVKKEL DIMEMLHFKG NV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-402453453110B-MYB
1h89_C2e-4023334344158MYB PROTO-ONCOGENE PROTEIN
1h88_C2e-4023334344158MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009334146.10.0PREDICTED: transcription factor MYB98-like
TrEMBLM5X7L21e-102M5X7L2_PRUPE; Uncharacterized protein (Fragment)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1709548
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27785.12e-51myb domain protein 118